DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-26

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:199 Identity:45/199 - (22%)
Similarity:74/199 - (37%) Gaps:52/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHNERRN-----LIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECR------NTN 120
            :||:.||     |.|...:|   .:..|..:.|:.:|...|.:....|    |:..      ..|
 Worm    33 VHNKLRNDASQGLWARHNIS---KSTDMQKLFWNNSLVAEAKHEMYDC----DQLEKRELTLGEN 90

  Fly   121 TYRYAGQNLSILFTRSVDVAVF----LRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVN 181
            .|:|             ||..:    .:|..||...::.||.|...:..|.|       ...::.
 Worm    91 IYQY-------------DVTTYDDVDGQQGEAAINKDSHDALSSKDQAAQYR-------LRQILY 135

  Fly   182 ERNNRVGC---AIARFTD-ANNVQATLLACNY--AVTNVVNNPVYRAG-TAASECTTGRNSNYP- 238
            .::|.:||   :..|..| ..|.....:.|.|  |:.| :::.:|..| .|.|.|.:|.:...| 
 Worm   136 SKSNSIGCIYESCDRIDDEGTNYNTRFIICKYSPALKN-IDDQLYEEGEEACSNCPSGTSCTDPM 199

  Fly   239 -NLC 241
             .||
 Worm   200 MKLC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 34/163 (21%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 33/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.