DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-8

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502510.1 Gene:scl-8 / 183345 WormBaseID:WBGene00008030 Length:210 Species:Caenorhabditis elegans


Alignment Length:208 Identity:50/208 - (24%)
Similarity:77/208 - (37%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CSGEFVQV-DAHIPLILQLHNERRNLIAGGGV----SGFPSAVQMATMSWDTTLAQLAAYNALQC 109
            |.|.:.|. :.....||..||:.|:.||.|..    :...||..|..|.||::|.|.|...|..|
 Worm    11 CVGVYAQFSEGGKQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGC 75

  Fly   110 RMAH---DECRNTNTY-RYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-G 169
            .|.|   |:....|.| .::|...|       |:..|.:....|| |...:....:...:.:. .
 Worm    76 HMQHSTNDKTIGENLYWEWSGDPFS-------DLDKFGKIATVAW-DHEFEQFGWNSNKFSLALF 132

  Fly   170 GPAIGHFTTMVNERNNRVGCAI---ARFTDANNVQATLLACNYAVT-NVVNNPVYRAGTAASECT 230
            ...:.|.|.:......::||.:   .|......:....:.|.|.|. |.....:|.:|...|.|.
 Worm   133 NTGVAHATQIAWAPTGKIGCGVKNCGRDARRGGLFQVAIVCQYRVRGNFFFKNIYNSGATCSACP 197

  Fly   231 TGRN-SNYPNLCS 242
            .|.: .....||:
 Worm   198 AGTSCEQSTGLCA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 37/158 (23%)
scl-8NP_502510.1 SCP 22..175 CDD:214553 37/160 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.