DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-7

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502509.1 Gene:scl-7 / 183344 WormBaseID:WBGene00008029 Length:209 Species:Caenorhabditis elegans


Alignment Length:220 Identity:58/220 - (26%)
Similarity:87/220 - (39%) Gaps:52/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VQVDAHIPL-------ILQLHNERRNLIAGG-----GVSGFPSAVQMATMSWDTTLAQLAAYNAL 107
            |.|.||...       ::..||..|:.||.|     |... .||..|..|.||.:|||.|...|.
 Worm    10 VCVGAHAQFSEGGKQSMVNAHNAVRSSIAKGEYVAKGTKK-DSATNMLKMKWDNSLAQSAQNYAN 73

  Fly   108 QCRMAHDECRNTNTYRYAGQNLSILFTRS--VDVAVFLRQRIAAWFDENRDATSGDMEDYQMRG- 169
            .|.|.|...::      .|:||...::.|  .|:..:::..:..|..|           :||.| 
 Worm    74 GCPMQHSPDKS------YGENLFWAYSSSPITDLDKYVQSAVDTWVSE-----------FQMFGW 121

  Fly   170 ----------GPAIGHFTTMVNERNNRVGCAIARFTDANNV-----QATLLACNYAVT-NVVNNP 218
                      ...|||.|.:......:|||. |:...|::|     :||:: |.|.|. |.:...
 Worm   122 NSNKFTTALWNTGIGHATQVAWSATGQVGCG-AKNCGADSVRVGSYKATIV-CQYKVPGNYLFKN 184

  Fly   219 VYRAGTAASECTTGRNSNYPN-LCS 242
            :|.:|...|.|..|.:....: ||:
 Worm   185 IYNSGAKCSACPAGTSCEQSSGLCA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 44/176 (25%)
scl-7NP_502509.1 SCP 22..174 CDD:214553 44/171 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.