DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-6

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502508.1 Gene:scl-6 / 183343 WormBaseID:WBGene00008028 Length:209 Species:Caenorhabditis elegans


Alignment Length:226 Identity:53/226 - (23%)
Similarity:81/226 - (35%) Gaps:68/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VQVDAHI-----PLILQLHNERRNLIAGG--GVSGF--PSAVQMATMSWDTTLAQLAAYNALQCR 110
            |.|||..     ..|:.|||..|:.:|.|  .::|.  |:...:..||||:|||..|...|..|.
 Worm    14 VLVDAEFSSSTQQFIVDLHNSFRSKLATGTYSINGTLKPAGSNIRKMSWDSTLATSAQTYANTCP 78

  Fly   111 MAHDECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPA--- 172
            ......:.|      |:||                   .|     ..||.::....:.||.|   
 Worm    79 TGFSNTQGT------GENL-------------------YW-----RTTSANISGLDIYGGAASVS 113

  Fly   173 -----------------------IGHFTTMVNERNNRVGCAIARF-TDANNVQATLLACNY-AVT 212
                                   :|:.|.|...:.|.|||.:... .|:..:....:.|:| .:.
 Worm   114 WEQEFQKYGWATNYFSQELFDTGVGNGTQMAWAKTNLVGCGVKNCGKDSTGLNKVAVVCHYKPLG 178

  Fly   213 NVVNNPVYRAGTAASECTTGRNSNY-PNLCS 242
            ..|:..:|.||...|:|.||.:.:. ..||:
 Worm   179 RYVDQMIYTAGFTCSQCPTGTSCDQTTGLCA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/178 (22%)
scl-6NP_502508.1 SCP 23..176 CDD:214553 39/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.