DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and C07A4.2

DIOPT Version :10

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:76 Identity:11/76 - (14%)
Similarity:25/76 - (32%) Gaps:35/76 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYP 238
            ||||.::.:.:.::|..::                          :.::.:..|.|.:.      
 Worm   351 GHFTQLIWKNSRKIGVGVS--------------------------IVKSSSIRSPCVSS------ 383

  Fly   239 NLCSPNEVYNY 249
               |||..:.|
 Worm   384 ---SPNMYFIY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 CAP_euk 63..210 CDD:349399 5/35 (14%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 11/76 (14%)

Return to query results.
Submit another query.