powered by:
Protein Alignment CG32679 and C07A4.2
DIOPT Version :9
Sequence 1: | NP_727412.2 |
Gene: | CG32679 / 318150 |
FlyBaseID: | FBgn0052679 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509706.2 |
Gene: | C07A4.2 / 182351 |
WormBaseID: | WBGene00007397 |
Length: | 417 |
Species: | Caenorhabditis elegans |
Alignment Length: | 76 |
Identity: | 11/76 - (14%) |
Similarity: | 25/76 - (32%) |
Gaps: | 35/76 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 GHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYP 238
||||.::.:.:.::|..:: :.::.:..|.|.:.
Worm 351 GHFTQLIWKNSRKIGVGVS--------------------------IVKSSSIRSPCVSS------ 383
Fly 239 NLCSPNEVYNY 249
|||..:.|
Worm 384 ---SPNMYFIY 391
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X35 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.