DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and vap-2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:256 Identity:70/256 - (27%)
Similarity:100/256 - (39%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FTFAQNYC-DPE-LC--PS-----GRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERRNLI 75
            ||:..:.| .|| ||  ||     |....|.||  .||..:..|.         |:.||..|:.:
 Worm   277 FTYPGSKCLVPEGLCQAPSMVKDDGGSFQCDNS--LVSDVTRNFT---------LEQHNFYRSRL 330

  Fly    76 AGGGVSGF----------PSAVQMATMSWDTTLAQLA---AYNALQCRMAHDECRNTNTYRYAGQ 127
            |    .||          |.|.||..|.:|..|.:.|   |.|.:....||.|..|      .||
 Worm   331 A----KGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAHYERPN------QGQ 385

  Fly   128 NLSILFTRSVDVAVFLRQRIAAWFDENRD-------ATSGDMEDYQMRGGPAIGHFTTMVNERNN 185
            ||.:....:.|....:...:..|:.|..:       ..:.::.|.:   |.||||:|.|..:|..
 Worm   386 NLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLK---GKAIGHYTQMAWDRTY 447

  Fly   186 RVGCAIARFTDANNVQATLLACNYA-VTNVVNNPVYRAGTAA---SECTTGRN-SNYPNLC 241
            |:||.|     ||..:.:.:.|:|. ..|..||.:|..|...   .:|..|.: ....:||
 Worm   448 RLGCGI-----ANCPKMSYVVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDCEKTTSLC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 44/166 (27%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 46/179 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.