DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-5

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502506.1 Gene:scl-5 / 178253 WormBaseID:WBGene00008027 Length:208 Species:Caenorhabditis elegans


Alignment Length:194 Identity:56/194 - (28%)
Similarity:82/194 - (42%) Gaps:19/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CSGEFVQVDAH-IPLILQLHNERRNLIAGGGV----SGFPSAVQMATMSWDTTLAQLAAYNALQC 109
            |:|.:.|..|: ...||.:||..|:.||.|..    :..|:|..|..|.||.|:|..|...|.:|
 Worm    12 CAGAYAQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKC 76

  Fly   110 RMAHDECRNTNTYRYAGQNLSILFTRS--VDVAVFLRQRIAAWFDENRDA--TSGDMEDYQMRGG 170
            ...|.....      .|:||...:|.:  .::..|.....|||..|.:|.  :|..:.......|
 Worm    77 PTGHSGAAG------LGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTG 135

  Fly   171 PAIGHFTTMVNERNNRVGCAIARF-TDANNVQATLLACNYAVT-NVVNNPVYRAGTAASECTTG 232
              |||.|.|...:.|.:||.:... .|.|......:.|.|... |.:|..:|.:||..|:|.:|
 Worm   136 --IGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 43/155 (28%)
scl-5NP_502506.1 SCP 22..175 CDD:214553 44/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.