DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Crispld2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:215 Identity:58/215 - (26%)
Similarity:84/215 - (39%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IPL-----ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTN 120
            ||:     ||.|||:.|..:       :|.|..|..|:||..|.:.||..|.:|...|..   .:
  Rat    51 IPMSDRQEILMLHNKLRGQV-------YPPASNMEYMTWDEELERSAAAWAQRCLWEHGP---AS 105

  Fly   121 TYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDY-----------QMRGGPAIG 174
            .....||||::.:.|......    .:.:|:||.:|.|      |           :...|....
  Rat   106 LLVSIGQNLAVHWGRYRSPGF----HVQSWYDEVKDYT------YPYPHECNPWCPERCSGAMCT 160

  Fly   175 HFTTMVNERNNRVGCAIARFTDANN-----VQATLLACNYAVT-NVVNNPVYRAGTAASECTTG- 232
            |:|.||....|::|||:......:.     ..|..|.|||:.. |.:....|:.|...|||.:. 
  Rat   161 HYTQMVWATTNKIGCAVHTCRSMSVWGDIWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSY 225

  Fly   233 ----RNSNYPNLCSPNEVYN 248
                ||    |||...|.|:
  Rat   226 GGGCRN----NLCYREEHYH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 42/167 (25%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 42/164 (26%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344684
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.