powered by:
Protein Alignment CG32679 and GLIPR2
DIOPT Version :9
Sequence 1: | NP_727412.2 |
Gene: | CG32679 / 318150 |
FlyBaseID: | FBgn0052679 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001273942.1 |
Gene: | GLIPR2 / 152007 |
HGNCID: | 18007 |
Length: | 169 |
Species: | Homo sapiens |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 32/68 - (47%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 WFDENRDATSGDMEDYQMRG-GPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTN 213
|:.|.:: .::|..| ....||||.||.:...::|...|..:|.::. ::|..:...|
Human 98 WYSEIKN------YNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSF---VVARYFPAGN 153
Fly 214 VVN 216
|||
Human 154 VVN 156
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2242 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X35 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.850 |
|
Return to query results.
Submit another query.