DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG43777

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:275 Identity:68/275 - (24%)
Similarity:121/275 - (44%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFAQNYCDPE----LCPSGRHVACQNSGRFVSGCSGEFVQVDAHIP----- 62
            |..||.:||:: ..|...|||:.:    :....:|..|......|.|.|.:|   .|.:|     
  Fly     3 WRLLLAVVLLL-PLTSGYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKF---HASVPNNMRM 63

  Fly    63 --LILQLHNERRNLIAGG-----GVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTN 120
              :.|.:.|..||..|||     |...|..|.:|..:.||..||.:...:|....:...:||:|.
  Fly    64 QKIALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQCRSTL 128

  Fly   121 TYRYAGQNLSILFTR-SVDVAVFLRQRIAAWFDENRDATSGDM--------EDYQMRGGPAIGHF 176
            .:.:.|:.::::..| .:::.....:.....|.|.:..:..|.        .|:|:|      ||
  Fly   129 RFPHVGEAIALVTPREKLNLKEIYSKAFTPMFAEYQHVSDPDALLHAFDPDRDFQVR------HF 187

  Fly   177 TTMVNERNNRVGCAIARFTDAN-NVQ-ATLLACNYAVTNVVNNPVYRAGTAASECT---TGRNSN 236
            |.::::|.:||||.:|...:.| ::: ...|.|.:...|:..:.||:||...|.|.   ...:..
  Fly   188 TNIISDRVSRVGCGVAVGANCNPSIKFCHFLTCYFDFHNMAGSYVYKAGDPTSSCDDWGVVSSDK 252

  Fly   237 YPNLC-SPNEVYNYN 250
            |.||| :..|::.::
  Fly   253 YANLCKNSGEIFPHD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/162 (24%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440621
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
76.850

Return to query results.
Submit another query.