DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Crisp3

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:248 Identity:61/248 - (24%)
Similarity:94/248 - (37%) Gaps:51/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERRNLIAG 77
            |:|::|   |......|.|......   :||...:| .|.:.||.:     |:..||:.|..:: 
Mouse     3 LMLVLF---FLAAVLPPSLLQDNSQ---ENSLEKLS-TSKKSVQEE-----IVSKHNQLRRKVS- 54

  Fly    78 GGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHD--ECRNTNTYRYAGQNLSILFTRSVDVA 140
                  ||...:..|.|:......|...|.:|..:|.  |.|.||.  ..|:|   ||..|  ..
Mouse    55 ------PSGSDLLNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNL--KCGEN---LFMSS--YL 106

  Fly   141 VFLRQRIAAWFDENRDATSGDMEDYQMRGGP-----AIGHFTTMVNERNNRVGCAIARFTDANNV 200
            |.....|..|::|::....|        .||     .:||.|.:|.:.|.:|.|.:|...:  |.
Mouse   107 VPWSSVIQGWYNESKGLIFG--------VGPKQNVSVVGHHTQVVWKSNLQVACGVAECPE--NP 161

  Fly   201 QATLLACNYAVTNVVN------NPVYRAGTAASECTTGRNSNYPNLCSPNEVY 247
            ......|.|.  .|:|      :..|.|.||.:.|.:..:.....||:.:..|
Mouse   162 LRYFYVCRYC--PVLNYSGHYPSRPYLAYTARAPCASCPDRCEDGLCTKSCQY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 38/153 (25%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 41/165 (25%)
Crisp 194..241 CDD:285731 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841436
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.