DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Crisp1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:189 Identity:46/189 - (24%)
Similarity:71/189 - (37%) Gaps:37/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHD--ECRNTNTYRYAG 126
            |:..||:.|.:::       ||...:..|.|:......|...|.:|..:|.  |.|.||.  ..|
Mouse    42 IVSKHNQLRRMVS-------PSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNL--RCG 97

  Fly   127 QNL---SILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGP-----AIGHFTTMVNER 183
            :||   |.|.:.|        ..|..|::|.:|.|      |.:  ||     .:||:|.:|...
Mouse    98 ENLFMSSYLASWS--------SAIQGWYNEYKDLT------YDV--GPKQPDSVVGHYTQVVWNS 146

  Fly   184 NNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYPNLCS 242
            ..:|.|.:|..  ..|.......|:|.........:|...||...|.:..:.....||:
Mouse   147 TFQVACGVAEC--PKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/155 (25%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 40/156 (26%)
Crisp 190..244 CDD:285731 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841435
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.