DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and GLIPR1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:254 Identity:61/254 - (24%)
Similarity:95/254 - (37%) Gaps:77/254 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLIIFTFTFAQNYCDPELCPSGRHVA-----CQNSGRFVSGCSGEFVQVDAHIPLILQLHNERR 72
            |..|.:..:|..||         .|.|     .:|.. |:..|              :::||:.|
Human     5 LATIAWMVSFVSNY---------SHTANILPDIENED-FIKDC--------------VRIHNKFR 45

  Fly    73 NLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTN---------TYRYAGQN 128
            :.:.       |:|..|..|:||..|||:|...|..|:.:|    ||.         .:...|:|
Human    46 SEVK-------PTASDMLYMTWDPALAQIAKAWASNCQFSH----NTRLKPPHKLHPNFTSLGEN 99

  Fly   129 LSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRG---GPAIGHFTTMVNERNNRVGCA 190
               ::|.||.: ..:...|..|:||        ::||..:.   ....||:|.:|...:.:||||
Human   100 ---IWTGSVPI-FSVSSAITNWYDE--------IQDYDFKTRICKKVCGHYTQVVWADSYKVGCA 152

  Fly   191 ------IARFTDANNVQATLLACNYAVTNVVNNPV--YRAGTAASECTTGRNSNYPNLC 241
                  ::.|...:|  .....|||....  |.|.  |:.|...|.| ...:....|||
Human   153 VQFCPKVSGFDALSN--GAHFICNYGPGG--NYPTWPYKRGATCSAC-PNNDKCLDNLC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/164 (25%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 44/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151231
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.