DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and glipr1a

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:236 Identity:61/236 - (25%)
Similarity:99/236 - (41%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VSGC------SGEF---VQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLA 102
            :|.|      |.|:   :...|.|...::.||:.|:.::       |:|..|..|:||..||..|
Zfish     9 ISACFLLGVFSSEYLFDITDRAFIDECVREHNQNRSSVS-------PTAANMRYMTWDAALAVTA 66

  Fly   103 AYNALQCRMAHD----ECRNTN-TYRYAGQNL--SILFTR-SVDVAVFLRQRIAAWFDENRDATS 159
            ...|..|...|:    |.:..: |:...|:|:  ...::| :|..|||      :|.:|.:|.  
Zfish    67 RAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVF------SWVNELKDY-- 123

  Fly   160 GDMEDYQMRGGPAIGHFTTMVNERNNRVGCAI------ARFTDANNVQATLLACNYAVT-NVVNN 217
             :..:.|.......||:|.:|...:.:||||:      ...|..:|:|..:..||||.. |....
Zfish   124 -NYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGR 187

  Fly   218 PVYRAGTAASECTTGRNSNYPNLC-----SPNEVYNYN-QW 252
            ..|:.|.:.|.| .|.:....|||     ...:.||:. .|
Zfish   188 SPYKQGASCSGC-GGSDKCERNLCRNTDRDAEQSYNWTPDW 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/160 (26%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.