powered by:
Protein Alignment CG32679 and CG42717
DIOPT Version :9
| Sequence 1: | NP_727412.2 |
Gene: | CG32679 / 318150 |
FlyBaseID: | FBgn0052679 |
Length: | 254 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001189115.1 |
Gene: | CG42717 / 10178897 |
FlyBaseID: | FBgn0261634 |
Length: | 96 |
Species: | Drosophila melanogaster |
| Alignment Length: | 37 |
Identity: | 10/37 - (27%) |
| Similarity: | 13/37 - (35%) |
Gaps: | 8/37 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 216 NNPVYRAGTAASECTTGRNSNYPNLCSPNEVYNYNQW 252
|..::...|....|| ..||.. |..|. |:|
Fly 55 NKNMWHYNTRTKNCT---QFNYLG-CGGNN----NRW 83
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG32679 | NP_727412.2 |
SCP_euk |
63..210 |
CDD:240180 |
|
| CG42717 | NP_001189115.1 |
KU |
<53..93 |
CDD:294074 |
10/37 (27%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.
