DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG42780

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster


Alignment Length:250 Identity:85/250 - (34%)
Similarity:128/250 - (51%) Gaps:20/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLLYLVLIIFTFTFAQNYCDPELCPSG-RHVACQN-SGRFVSGCSGEFVQVDAHI---PLILQL 67
            ||:|.|||    .:.|:|:|..:||..| .|:|||| :|.|.|.|..:...:..::   ..:::.
  Fly     8 IFVLSLVL----HSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKA 68

  Fly    68 HNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNL--- 129
            ||..|...|.|......:|.:||.|.|:..|.:||..||..|.|.||||.||..:|.:||||   
  Fly    69 HNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAM 133

  Fly   130 -----SILFTR-SVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVG 188
                 .|..|: ::.:::.....:..|..|.:|.|:.|::.........|||.|.::||::|.||
  Fly   134 GFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVG 198

  Fly   189 CAIARFTDANNVQATLLACNYAVTNVVNNPVY-RAGTAASECTTGRNSNYPNLCS 242
            |.:..: :...::...||||||.|||:...|| ....|..||..|.:..||.||:
  Fly   199 CGLVAY-NLGEIRRYNLACNYAYTNVIGERVYEECAKAGIECAKGIDQKYPPLCA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 49/155 (32%)
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 49/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440532
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.