DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and pi16

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031751055.1 Gene:pi16 / 101731805 XenbaseID:XB-GENE-22068880 Length:548 Species:Xenopus tropicalis


Alignment Length:199 Identity:56/199 - (28%)
Similarity:88/199 - (44%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQ 127
            :||..||..|:...       |||..|..::||:.|..:|...|.:|...|::.|.     :.|:
 Frog    32 IILDKHNFYRSQTE-------PSASDMIKLTWDSALEAMAKSYAEKCIWEHNKDRG-----FIGE 84

  Fly   128 NLSILFTRSVDVAVFLRQRIAAWFDEN--RDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCA 190
            ||.::...|:|||:.|..    |..|.  .:.|:|..::.||     .||:|.||.....||||.
 Frog    85 NLFVMSGSSLDVALGLDD----WHKERGYYNFTTGMCQEGQM-----CGHYTQMVWAGTERVGCG 140

  Fly   191 ---IARFTDANNVQATLLACNYAVT-NVVNNPVYRAGTAASECTTGRNSNYPNLC-SPNEVYNYN 250
               ..:....::....||.|||... |......|:.|:..:||.:. :....:|| :.||....:
 Frog   141 QNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSD-HVCIGSLCENMNETEKSS 204

  Fly   251 QWSG 254
            |.:|
 Frog   205 QVAG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 44/151 (29%)
pi16XP_031751055.1 CAP_PI16_HrTT-1 30..163 CDD:349405 44/151 (29%)
PHA03247 <200..414 CDD:223021 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.