DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and LOC100536500

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:218 Identity:57/218 - (26%)
Similarity:82/218 - (37%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAA 103
            ||.     |:|...|...|...   |:.:||..|..:.       |||..|..|||...:|:.|.
Zfish    26 ACS-----VTGVCTELSSVQQE---IVDVHNAFRRAVQ-------PSASNMLKMSWSDAVAESAR 75

  Fly   104 YNALQCRMAH--DECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQ 166
            ....:|.|.|  ...|..|.|. .|:||            |....|::| ....||...::.:|:
Zfish    76 GWINKCNMTHGPPSSRMLNGYE-MGENL------------FKATGISSW-TSVVDAWHSEVNNYK 126

  Fly   167 MR----GGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAG---- 223
            ..    .|.|.||:|.:|...:..||||:.:.  .:|.   ...|:|          ||||    
Zfish   127 YPIGSINGQATGHYTQVVWYSSYEVGCAVTQC--GSNY---FYGCHY----------YRAGNFRT 176

  Fly   224 ----TAASECTTGRNSNYPNLCS 242
                :..|.|.:..|:...|||:
Zfish   177 VPPYSLGSPCASCPNNCEDNLCT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 40/152 (26%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.