DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and r3hdml

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:199 Identity:57/199 - (28%)
Similarity:85/199 - (42%) Gaps:35/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
            :|..||:.|:.:       ||.|..|..|.||..||:.|...|.||:..|..   ....||.|||
 Frog    66 LLDYHNQVRSKV-------FPPAANMEYMVWDERLAKSAESWANQCKWDHGP---NQLMRYIGQN 120

  Fly   129 LSI---LFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-----GGPAIGHFTTMVNERNN 185
            ||:   .:...||:       :..|:||.:..:.....:....     .|....|:|.||...:|
 Frog   121 LSVHSGRYRSIVDL-------VKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSN 178

  Fly   186 RVGCAIARFTDANN-----VQATLLACNYAVT-NVVNNPVYRAGTAASECTTGRNSNYPNLCSPN 244
            |:|||:...|:.|.     .||:.|.|||::. |.:....|:.|...|.|.    .:|..:||.|
 Frog   179 RIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACP----PSYGGVCSNN 239

  Fly   245 EVYN 248
            ..::
 Frog   240 MCFS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 47/158 (30%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 47/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.