DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and crispld1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:213 Identity:61/213 - (28%)
Similarity:85/213 - (39%) Gaps:41/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEFVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDEC 116
            |:....::.:.|||.|||:.|..:       :|.|..|..|.||..|.:.|...|..|...|.. 
 Frog    53 GKRAITESDMKLILDLHNKLRGEV-------YPPASNMEFMIWDVELERSAEAWAETCLWEHGP- 109

  Fly   117 RNTNTYRYAGQNLSILFTRSVDVAVFLRQR-----IAAWFDENRDAT---SGDMEDY-QMR-GGP 171
              .:.....||||.         |.:.|.|     :.||:||.||.|   ..:.:.| ..| .||
 Frog   110 --ADLLPVIGQNLG---------AHWGRYRPPTYHVQAWYDEVRDYTFPYPQECDPYCPFRCSGP 163

  Fly   172 AIGHFTTMVNERNNRVGCAIARFTDANNV------QATLLACNYAVT-NVVNNPVYRAGTAASEC 229
            ...|:|.:|...::|:|||| ......||      :|..|.|||:.. |...:..|:.|...|.|
 Frog   164 VCTHYTQLVWATSSRIGCAI-NLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPYKHGHPCSAC 227

  Fly   230 TTGRNSNYPNLCSPNEVY 247
            .    .:|...|..|..|
 Frog   228 P----PSYGGGCKDNLCY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 50/162 (31%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 50/164 (30%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.