DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and LOC100490275

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:253 Identity:57/253 - (22%)
Similarity:100/253 - (39%) Gaps:53/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFAQNYCDP-ELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNE 70
            |:..|.||:.:         |.. :|.|:..:    |:.|||:.              ::..||:
 Frog     2 WLPQLMLVVSV---------CGARQLDPTPAY----NNERFVTD--------------LVNAHND 39

  Fly    71 RRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNT----YRYAGQNLSI 131
            .||...       ..|..|..||||..||:||....:.|:...:...|..:    ::..|:||  
 Frog    40 IRNEFG-------KQAANMLHMSWDVGLAKLAQAWTINCKKVPNPHLNKESIYPRFKQIGENL-- 95

  Fly   132 LFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTD 196
            ....|:|:.    :.:..|   ..:....|:::...:.|....|||.:|.....:|||..|..  
 Frog    96 YMGPSIDIF----KIVTNW---GLEGNFYDLKNNSCQPGKDCSHFTQIVWANTYKVGCGAAYC-- 151

  Fly   197 ANNVQATLLACNYAVT-NVVNNPVYRAGTAASECTTGRNSNYPNLCSPNEVYNYNQWS 253
            |:.| |.:::|.|... |::....:..|...|:| .|...|..:..:|:...||..::
 Frog   152 AHKV-AYVVSCTYGPRGNLLGQVPFILGVKCSKC-GGEKCNVASCGNPSRDENYGDYN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 36/150 (24%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.