DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and crisp1.6

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002933627.1 Gene:crisp1.6 / 100379939 XenbaseID:XB-GENE-5838744 Length:237 Species:Xenopus tropicalis


Alignment Length:202 Identity:51/202 - (25%)
Similarity:78/202 - (38%) Gaps:41/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHD-ECRNTNTYRYAG 126
            :|:..||..|..:.       |||..|..|.|....|..||..:..|..||. ..:.|.:....|
 Frog    36 VIVDTHNGYRRSVN-------PSARNMLKMMWSEAAASNAATWSATCPAAHSPTSQRTISGVTCG 93

  Fly   127 QNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGP-----AIGHFTTMVNERNNR 186
            :|            :|:....|:| .|...|.:.:.:.:|...||     ..||:|.:|...:..
 Frog    94 EN------------IFIASYPASW-QEAITAWNSESQYFQYGVGPTSSNQVTGHYTQLVWYNSYM 145

  Fly   187 VGCAIARFTDANNVQATLLACNYAV----TNVVNNPVYRAGTAASECTTG-RNSNYPNLCSPNEV 246
            ||||:   ::.||  ..:..|.|..    .|.:..| |::|.|..:|... .|....|.|...::
 Frog   146 VGCAV---SNCNN--QYIYVCQYCPMGNNLNTITTP-YKSGPACGDCPGACDNGLCTNPCPYQDM 204

  Fly   247 Y----NY 249
            |    ||
 Frog   205 YSGCSNY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 38/152 (25%)
crisp1.6XP_002933627.1 CAP_CRISP 32..166 CDD:349402 39/154 (25%)
Crisp 183..236 CDD:369954 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.