DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and crispld1a

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:272 Identity:65/272 - (23%)
Similarity:101/272 - (37%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PCWIFLLYL-----VLIIFTFT----FAQNYCDPELCPSGRHVACQNSG-RFVSGCSGEFVQVDA 59
            |..:|||.:     .:::|..|    ..:.|.:.:        |..::| |.:....|:.....:
Zfish     9 PTGLFLLLVTRTVFAMVLFNATDLGFLLEKYLEDD--------ADDDAGDRVMERQRGKRAITAS 65

  Fly    60 HIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRY 124
            .:..||.|||:.|..:       :|.|..|..|.||..|.:.|...|..|...|..   ......
Zfish    66 DMQAILDLHNKLRGQV-------YPPASNMEYMVWDNELERSAEEWAETCLWEHGP---AGLLPQ 120

  Fly   125 AGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-------------GGPAIGHF 176
            .||||.:.:.|.....    ..:.||:||        ::||...             .||...|:
Zfish   121 IGQNLGVHWGRYRPPT----SHVQAWYDE--------VKDYSFPYPQECNPHCPFRCSGPVCTHY 173

  Fly   177 TTMVNERNNRVGCAIARFTDANN-----VQATLLACNYAVT-NVVNNPVYRAGTAASECTTGRNS 235
            |.:|...::|:||||....:.|.     .:|..|.|||:.. |......|:.||:.|.|.    .
Zfish   174 TQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACP----P 234

  Fly   236 NYPNLCSPNEVY 247
            :|..:|..|..|
Zfish   235 SYGGVCRENLCY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 43/164 (26%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 43/165 (26%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585679
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.