DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and SEC4

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:70/164 - (42%)
Similarity:101/164 - (61%) Gaps:3/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||:..||:|:|||||||:|||:||.:::|.....:|:|:|.:..:|:....::  .||:|||:..
Yeast    17 YDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV--KLQLWDTAGQ 79

  Fly    69 ERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133
            |||:.:.....|.|.||:||||:|..::|.||..|.|.:.....|:..:||||||| |...|.|:
Yeast    80 ERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKS-DMETRVVT 143

  Fly   134 MAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLA 167
            ..||...|....|.|.|.|||:..||.:||.:||
Yeast   144 ADQGEALAKELGIPFIESSAKNDDNVNEIFFTLA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 68/160 (43%)
Rab 8..167 CDD:206640 66/158 (42%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 69/163 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.