DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and RABE1e

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_187601.1 Gene:RABE1e / 820148 AraportID:AT3G09900 Length:218 Species:Arabidopsis thaliana


Alignment Length:170 Identity:80/170 - (47%)
Similarity:107/170 - (62%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTS 66
            |.||...|::|:|||||||:|||:||||:.|||...:|:|:|.:..:||....|:  .||:|||:
plant    10 SDYDYLIKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRI--KLQIWDTA 72

  Fly    67 DDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSD-DPNHR 130
            ..|||:.:.....|.|.|||||||:|...||.||..|||.|.:...|.|..:|||||:| |.:.|
plant    73 GQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDSVNKILVGNKADMDESKR 137

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            .|..::|...|....|.|.|.|||:.:||..:|.|:|.||
plant   138 AVPTSKGQALADEYGIKFFETSAKTNQNVEQVFLSIAKDI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 77/164 (47%)
Rab 8..167 CDD:206640 74/159 (47%)
RABE1eNP_187601.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 78/167 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.