Sequence 1: | NP_727432.1 | Gene: | Rab9D / 318149 | FlyBaseID: | FBgn0067052 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016873867.1 | Gene: | RAB1B / 81876 | HGNCID: | 18370 | Length: | 237 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 73/206 - (35%) |
---|---|---|---|
Similarity: | 112/206 - (54%) | Gaps: | 42/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR--MLQVWDT 65
Fly 66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
Fly 131 QV-----SMAQG-------------------------FN------YAHRQSICFEEVSAKSGRNV 159
Fly 160 YDIFSSLAMDI 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab9D | NP_727432.1 | RAB | 8..171 | CDD:197555 | 71/201 (35%) |
Rab | 8..167 | CDD:206640 | 69/196 (35%) | ||
RAB1B | XP_016873867.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0084 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1149105at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |