DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and rab15

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001016372.1 Gene:rab15 / 549126 XenbaseID:XB-GENE-495026 Length:212 Species:Xenopus tropicalis


Alignment Length:199 Identity:74/199 - (37%)
Similarity:114/199 - (57%) Gaps:8/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSD 67
            |||..|:::|:|||||||||||.||:||:|...|.||:|:|.:..::|....::  .:|:|||:.
 Frog     4 QYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHPSHISTIGVDFKMKTIEVDGIKV--RIQIWDTAG 66

  Fly    68 DERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQV 132
            .||::.:.....|.|.||.|||||||.:|:|:|..|..::....||.|..:|:|||:|:...|||
 Frog    67 QERYQTITKQYYRRAQGIFLVYDITSERSYQHIMKWASDVDEYAPDGVQKILIGNKADEEQKRQV 131

  Fly   133 SMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQE------EED 191
            ...||...|....:.|.|.||.:..|:.:.|:.|...:....:.......::|..|      |:|
 Frog   132 GKNQGMKLAEEYGMDFFETSACTNYNIKESFTRLTELVLMAHKRELEGLRMSSADELNLAELEDD 196

  Fly   192 AAES 195
            .::|
 Frog   197 GSKS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 66/162 (41%)
Rab 8..167 CDD:206640 65/158 (41%)
rab15NP_001016372.1 Rab15 9..172 CDD:206698 66/164 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.