DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and Rab43

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001019502.1 Gene:Rab43 / 500249 RGDID:1565300 Length:210 Species:Rattus norvegicus


Alignment Length:198 Identity:70/198 - (35%)
Similarity:115/198 - (58%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||..||::|:||:.|||||::.||....|:.|..||:|:|....::|....|:  .||:|||:..
  Rat    13 YDFLFKLVLVGDASVGKTCVVQRFKTGAFSARQGSTIGVDFTMKTLEIQGKRV--KLQIWDTAGQ 75

  Fly    69 ERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133
            |||:.:..:..|||:|.:|.|||:...:|.::..|::::|:.....::.||:|||||..:.|:|.
  Rat    76 ERFRTITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLADLREVP 140

  Fly   134 MAQGFNYA-HRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNP-FSLTSWQ----EEEDA 192
            :|:..:.| |...:|..|.|||...||.:.|:.:|.::...   |..| ||..:..    :.:|.
  Rat   141 LAEAQSLAEHYDILCAIETSAKDSSNVEEAFTRVATELIMR---HGGPMFSEKNTDHIQLDSKDI 202

  Fly   193 AES 195
            |||
  Rat   203 AES 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 60/163 (37%)
Rab 8..167 CDD:206640 59/159 (37%)
Rab43NP_001019502.1 Rab19 14..178 CDD:133267 61/165 (37%)
Effector region. /evidence=ECO:0000250 45..53 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.