DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and rab1a

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001004787.1 Gene:rab1a / 448007 XenbaseID:XB-GENE-485527 Length:204 Species:Xenopus tropicalis


Alignment Length:195 Identity:74/195 - (37%)
Similarity:114/195 - (58%) Gaps:10/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR--MLQVWDT 65
            :||..||::|:|||||||:|||:||:|:.:|..:.||:|:|.:..::|..    |:  .||:|||
 Frog     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELD----GKTIKLQIWDT 67

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..|||:.:.::..|.||||::|||:|..:||.|:..|::||.|...:.|..||||||.|....:
 Frog    68 AGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKK 132

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAAES 195
            .|.......:|....|.|.|.|||:..||...|.::|.:|    :....|.:....||:....:|
 Frog   133 VVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEI----KKRMGPGATAGGQEKNVKIQS 193

  Fly   196  195
             Frog   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 67/164 (41%)
Rab 8..167 CDD:206640 66/160 (41%)
rab1aNP_001004787.1 Rab1_Ypt1 10..175 CDD:206661 68/172 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.