DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and rab30

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001002750.1 Gene:rab30 / 437023 ZFINID:ZDB-GENE-040718-250 Length:201 Species:Danio rerio


Alignment Length:170 Identity:65/170 - (38%)
Similarity:103/170 - (60%) Gaps:2/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDT 65
            |..||..|||:|:|::|||||||:.||:...|.....:|:|:|....:||....::  .||:|||
Zfish     1 MEDYDYLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEIKGVKV--KLQIWDT 63

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..|||:.:..:..|||:.::|.||||...||:.:..|::||.:...::|:.:|||||.|..:.|
Zfish    64 AGQERFRSITQSYYRSANALILTYDITCEDSFRCLPEWLREIEQYANNQVVTILVGNKIDLADKR 128

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            :|...:...:|..||:.:.|.|||...||..:|..||.::
Zfish   129 EVLRQRAEEFADSQSMLYLETSAKESDNVEKLFLDLACEL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 62/163 (38%)
Rab 8..167 CDD:206640 60/158 (38%)
rab30NP_001002750.1 Rab30 1..169 CDD:133314 65/170 (38%)
RAB 8..170 CDD:197555 62/163 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.