Sequence 1: | NP_727432.1 | Gene: | Rab9D / 318149 | FlyBaseID: | FBgn0067052 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001295083.1 | Gene: | RAB15 / 376267 | HGNCID: | 20150 | Length: | 212 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 74/200 - (37%) |
---|---|---|---|
Similarity: | 115/200 - (57%) | Gaps: | 10/200 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSD 67
Fly 68 DERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQV 132
Fly 133 SMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLA--------MDIYTYRRVHYNPFSLTSWQEE 189
Fly 190 EDAAE 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab9D | NP_727432.1 | RAB | 8..171 | CDD:197555 | 64/170 (38%) |
Rab | 8..167 | CDD:206640 | 63/158 (40%) | ||
RAB15 | NP_001295083.1 | Rab15 | 9..172 | CDD:206698 | 64/164 (39%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..212 | 3/8 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1149105at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |