DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and Rab5

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:167 Identity:61/167 - (36%)
Similarity:89/167 - (53%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVG---LDRREC----SVEFADWRMGRMLQVWDT 65
            ||::|||:|.|||:.|::||...||.....||:|   |.:..|    .|:|         ::|||
  Fly    30 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKF---------EIWDT 85

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..||:..|.....|.|...::||||.:..|||....|:||:.:.....:::.|.|||:|..|.|
  Fly    86 AGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIR 150

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLA 167
            .|...:...||....:.|.|.|||:|.||.|||.::|
  Fly   151 VVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 61/167 (37%)
Rab 8..167 CDD:206640 60/165 (36%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 61/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.