DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and Rab40

DIOPT Version :10

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster


Alignment Length:177 Identity:63/177 - (35%)
Similarity:86/177 - (48%) Gaps:21/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIILLGDSGVGKTCLLMRFSD----------NQFTTRHRSTVGLDRRECSVEFADWRMGR 58
            ||...|::|:|||.|||..:|....|          |..|:....||........:|      |:
  Fly     8 YDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLE------GK 66

  Fly    59 --MLQVWDTSDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVG 121
              .||:||||...||..:..:..|.|.||:||||||:..||..||.|:||:....|. :..:|||
  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVG 130

  Fly   122 NKSDDPNHRQVSMAQGFNYAHRQSI-CFEEVSAKSGRNVYDIFSSLA 167
            |:......|||:..|...||.|.:: || |:|.....|:.:.|..||
  Fly   131 NRLHLAFKRQVAAKQAETYASRNNMSCF-EISPLCNFNIRESFCELA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 Rab 8..167 CDD:206640 59/171 (35%)
Rab40NP_727611.1 P-loop containing Nucleoside Triphosphate Hydrolases 6..265 CDD:476819 63/177 (36%)
SOCS 192..234 CDD:470605
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.