DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and Rab40

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster


Alignment Length:177 Identity:63/177 - (35%)
Similarity:86/177 - (48%) Gaps:21/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIILLGDSGVGKTCLLMRFSD----------NQFTTRHRSTVGLDRRECSVEFADWRMGR 58
            ||...|::|:|||.|||..:|....|          |..|:....||........:|      |:
  Fly     8 YDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLE------GK 66

  Fly    59 --MLQVWDTSDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVG 121
              .||:||||...||..:..:..|.|.||:||||||:..||..||.|:||:....|. :..:|||
  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVG 130

  Fly   122 NKSDDPNHRQVSMAQGFNYAHRQSI-CFEEVSAKSGRNVYDIFSSLA 167
            |:......|||:..|...||.|.:: || |:|.....|:.:.|..||
  Fly   131 NRLHLAFKRQVAAKQAETYASRNNMSCF-EISPLCNFNIRESFCELA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 61/173 (35%)
Rab 8..167 CDD:206640 59/171 (35%)
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 63/177 (36%)
RAB 12..182 CDD:197555 61/173 (35%)
SOCS 192..234 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.