DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and RAB30

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001272988.1 Gene:RAB30 / 27314 HGNCID:9770 Length:203 Species:Homo sapiens


Alignment Length:175 Identity:67/175 - (38%)
Similarity:104/175 - (59%) Gaps:2/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDT 65
            |..||..|||:|:|::|||||||:.||:...|.....:|:|:|....:||....::  .||:|||
Human     3 MEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKV--KLQIWDT 65

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..|||:.:..:..|||:.::|.||||..:||:.:..|::||.:...:|||.:|||||.|....|
Human    66 AGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERR 130

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRR 175
            :||..:...::..|.:.:.|.|||...||..:|..||..:.:..|
Human   131 EVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEAR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 63/162 (39%)
Rab 8..167 CDD:206640 61/158 (39%)
RAB30NP_001272988.1 Rab30 3..171 CDD:133314 66/169 (39%)
Effector region. /evidence=ECO:0000250 38..46 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.