DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and RAB26

DIOPT Version :10

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_055168.2 Gene:RAB26 / 25837 HGNCID:14259 Length:256 Species:Homo sapiens


Alignment Length:168 Identity:69/168 - (41%)
Similarity:98/168 - (58%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIILLGDSGVGKTCLLMRFSDNQFTT-RHRSTVGLDRRECSVEFADWRMGRMLQVWDTSD 67
            ||..||::|:|||||||||||:||.|..|.. ...||||:|.|...::....::  .||:|||:.
Human    60 YDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKV--KLQMWDTAG 122

  Fly    68 DERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQV 132
            .|||:.:.....|.||.:||:||:|:..||.||..|:.||.......|.::|:|||.|..:.|.|
Human   123 QERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVV 187

  Fly   133 SMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            ....|...|....:.|.|.|||:|.||...|:::|.::
Human   188 KREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKEL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 Rab 8..167 CDD:206640 66/159 (42%)
RAB26NP_055168.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Rab26 64..254 CDD:206695 67/164 (41%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 86..101 5/14 (36%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 119..136 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.