DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and ypt1

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_596205.1 Gene:ypt1 / 2539784 PomBaseID:SPBC1703.10 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:73/182 - (40%)
Similarity:111/182 - (60%) Gaps:8/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR--MLQVWDT 65
            :||..||::|:|||||||:|||:||:|:.:|..:.||:|:|.:..:.|..    |:  .||:|||
pombe     4 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTFELE----GKTVKLQIWDT 64

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..|||:.:.::..|.||||::|||:|...||.|:..|::||.|...:.|..||||||||..:.:
pombe    65 AGQERFRTITSSYYRGAHGIIIVYDVTDQDSFNNVKQWLQEIDRYAVEGVNRLLVGNKSDMVDKK 129

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFS 182
            .|..:....:|...:|.|.|.|||...||...|.:::..|  ..|:..|.|:
pombe   130 VVEYSVAKEFADSLNIPFLETSAKDSTNVEQAFLTMSRQI--KERMGNNTFA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 67/164 (41%)
Rab 8..167 CDD:206640 67/160 (42%)
ypt1NP_596205.1 Rab1_Ypt1 7..172 CDD:206661 68/170 (40%)
RAB 9..172 CDD:197555 68/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.