DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and F08G12.1

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_509888.1 Gene:F08G12.1 / 181320 WormBaseID:WBGene00008585 Length:635 Species:Caenorhabditis elegans


Alignment Length:179 Identity:48/179 - (26%)
Similarity:79/179 - (44%) Gaps:50/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR-----MLQV 62
            ||:  .||::.||..||||||..|.....|...:.:|     .|..|...:|....     .:.|
 Worm    41 QYN--LKIVIRGDRNVGKTCLWKRLQGLSFQEEYVAT-----EEIQVANINWNYRATDDVVKVDV 98

  Fly    63 WDTSD--------DERFKL------------LKATQC--------RSAHGILLVYDITSSKSFQN 99
            ||..|        |::.||            .:.|.|        :..:|::.|:|||.:.:::.
 Worm    99 WDIVDQSTKKRVKDDKLKLANNGMDKNDGLDYEDTACDARFVDVYKGTNGVIFVFDITKTWTWEY 163

  Fly   100 IDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQV------SMAQGFNYAH 142
            :   .|||.:: |:|:.||::.|:.|..:||||      :..:.||.:|
 Worm   164 V---QKEIVKV-PNKIPVLVLANRRDMGHHRQVTDLQCSTFVELFNSSH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 46/174 (26%)
Rab 8..167 CDD:206640 46/174 (26%)
F08G12.1NP_509888.1 P-loop_NTPase 44..>193 CDD:304359 42/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.