DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and K02E10.1

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_508455.2 Gene:K02E10.1 / 180554 WormBaseID:WBGene00019317 Length:218 Species:Caenorhabditis elegans


Alignment Length:167 Identity:63/167 - (37%)
Similarity:107/167 - (64%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR---MLQVWDT 65
            |::.|||:::||...||:|:|:||::|.|...|.||:|:|.:..::     ::||   .|::|||
 Worm     3 YNHLFKIVVVGDHNCGKSCILLRFAENSFRMDHISTLGVDFKLKTI-----KLGRDKIRLELWDT 62

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDG-WMKEIRRLCPDKVIVLLVGNKSDDPNH 129
            :..||::.:..:...||||::.|||:|:.|||:|::. |:|||::..|...:::|||||:|....
 Worm    63 AGMERYRTIYNSYYHSAHGVMCVYDMTNEKSFENLEKYWLKEIKQHAPPNAVLMLVGNKADMDQE 127

  Fly   130 RQVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSL 166
            |:|...:....|.|..:...|||||:|.|..:.|.:|
 Worm   128 RKVDFDRAEKLASRLGVSLYEVSAKTGINCEEAFHTL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 62/163 (38%)
Rab 8..167 CDD:206640 62/163 (38%)
K02E10.1NP_508455.2 Rab 7..165 CDD:206640 62/163 (38%)
RAB 7..164 CDD:197555 61/161 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.