DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and zgc:171927

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001096112.1 Gene:zgc:171927 / 100124616 ZFINID:ZDB-GENE-070822-21 Length:210 Species:Danio rerio


Alignment Length:170 Identity:69/170 - (40%)
Similarity:106/170 - (62%) Gaps:6/170 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR--MLQVWDT 65
            :||..||::|:|||||||:|||:||:|:.:|..:.||:|:|.:..::|..    |:  .||:|||
Zfish     4 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIEME----GKTVKLQIWDT 64

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..|||:.:.::..|.||||::|||:|..:||.|:..|::||.|...:.|..||||||||..:.:
Zfish    65 AGQERFRTITSSYYRGAHGIIIVYDVTEQESFNNVKQWLEEIDRYACENVSKLLVGNKSDLSSKK 129

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            .|.......:.....|...|.|||:..||...|.::|.:|
Zfish   130 VVDFTTAMEFTESLKIPLLETSAKNANNVEKAFLAMASEI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 67/165 (41%)
Rab 8..167 CDD:206640 65/160 (41%)
zgc:171927NP_001096112.1 Rab1_Ypt1 7..172 CDD:206661 67/167 (40%)
RAB 9..172 CDD:197555 67/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.