DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9D and rabl6b

DIOPT Version :9

Sequence 1:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_005172002.1 Gene:rabl6b / 100003036 ZFINID:ZDB-GENE-081104-97 Length:776 Species:Danio rerio


Alignment Length:204 Identity:45/204 - (22%)
Similarity:75/204 - (36%) Gaps:66/204 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR-----MLQV 62
            ||:  .||::.||...||:.|..|....:|...:..|     :|..|....|....     .::|
Zfish    42 QYN--MKIVIRGDRNTGKSTLWHRLQGKKFQEEYIPT-----QEIQVTSIHWNYKTTDDVVKVEV 99

  Fly    63 WDTSD-----------------DERFKLLKATQ----------------CRSAHGILLVYDITSS 94
            ||..|                 .|..||....|                .::.:|:::::|||..
Zfish   100 WDVVDKGQKIPLPEGVGKGKKKSEALKLENEPQEQAESELALDAEFLDVYKNCNGVIMMFDITKQ 164

  Fly    95 KSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQV------------SMAQGFNYAHRQSIC 147
            .::..|   ::|:.:: |..|.|.::||..|...||.|            :...|.:|.|     
Zfish   165 WTYNYI---LRELPKV-PTHVPVCVLGNYRDMGEHRVVLPDDIRDFITGLNRPLGSSYIH----- 220

  Fly   148 FEEVSAKSG 156
            :.|.|.|:|
Zfish   221 YAESSMKNG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DNP_727432.1 RAB 8..171 CDD:197555 43/199 (22%)
Rab 8..167 CDD:206640 43/199 (22%)
rabl6bXP_005172002.1 P-loop_NTPase 45..233 CDD:328724 43/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.