DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and RAB33A

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_004785.1 Gene:RAB33A / 9363 HGNCID:9773 Length:237 Species:Homo sapiens


Alignment Length:176 Identity:65/176 - (36%)
Similarity:92/176 - (52%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDDERFK 72
            ||||::|||.||||||..||....|..:..:|:|:|.||.:||....::  .:|||||:..|||:
Human    37 FKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKI--KVQVWDTAGQERFR 99

  Fly    73 LLKATH-CRSAHGILLVYDITSSKSFQNIDGWMKEIR-RLCPDKVIVLLVGNKSDDPNHRQVSMA 135
            .....| .|:.|.::.|||:|...||.|:..|::|.. ...|..|..:|||||.|.....||...
Human   100 KSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSN 164

  Fly   136 QGFNYAHRQSICFEEVSA---KSGRNVYDIFSSLAMDIYTYRRVHY 178
            ....:|...::...|.||   |..:||..||..||..:...:.:.|
Human   165 LALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 64/167 (38%)
Rab 8..167 CDD:206640 62/163 (38%)
RAB33ANP_004785.1 Rab33B_Rab33A 35..204 CDD:133315 64/168 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.