DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and RAB33B

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_011530601.1 Gene:RAB33B / 83452 HGNCID:16075 Length:277 Species:Homo sapiens


Alignment Length:174 Identity:66/174 - (37%)
Similarity:102/174 - (58%) Gaps:11/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDDERFK 72
            ||||::|||.||||||..||...:|..|..:|:|:|.||.:||....|:  .:|:|||:..|||:
Human    82 FKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERI--KIQLWDTAGQERFR 144

  Fly    73 LLKATH-CRSAHGILLVYDITSSKSFQNIDGWMKEIRR-LCPDKVIVLLVGNKSDDPNHRQV--S 133
            .....| .|:.|.::.|||:|:..||.::..|::|.:: |..:.:..:|||||.|..:..||  .
Human   145 KSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTD 209

  Fly   134 MAQGFNYAHRQSICFEEVSAKS---GRNVYDIFSSLAMDIYTYR 174
            :||.|...|  |:...|.|||:   ..:|..||.:||..:.:::
Human   210 LAQKFADTH--SMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 66/169 (39%)
Rab 8..167 CDD:206640 64/165 (39%)
RAB33BXP_011530601.1 Rab33B_Rab33A 80..249 CDD:133315 66/170 (39%)
RAB 82..248 CDD:197555 66/169 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.