DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and RAB1C

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_193486.1 Gene:RAB1C / 827468 AraportID:AT4G17530 Length:202 Species:Arabidopsis thaliana


Alignment Length:172 Identity:69/172 - (40%)
Similarity:107/172 - (62%) Gaps:6/172 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGR--MLQVWDT 65
            :||..||::::|||||||:|||:||:|:.:...:.||:|:|.:..:||    :.|:  .||:|||
plant     4 EYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVE----QDGKTIKLQIWDT 64

  Fly    66 SDDERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..|||:.:.:::.|.||||::.||:|..:||.|:..|:.||.|...:.|..||||||.|..:.:
plant    65 AGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTSQK 129

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYT 172
            .||......:|....|.|.|.|||:..||.:.|.::...|.|
plant   130 VVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 65/164 (40%)
Rab 8..167 CDD:206640 65/160 (41%)
RAB1CNP_193486.1 Rab1_Ypt1 7..172 CDD:206661 67/169 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.