DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and CPLANE2

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_112169.2 Gene:CPLANE2 / 79363 HGNCID:28127 Length:258 Species:Homo sapiens


Alignment Length:211 Identity:41/211 - (19%)
Similarity:77/211 - (36%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMD--------RRECSVEFADWRMGRMLQVWD 64
            :||.:.|.||||||.|:.:.:..:....|..|.|:.        :.:.|.....:|    .:.||
Human    56 YKIFVSGKSGVGKTALVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFR----FEFWD 116

  Fly    65 TSDD--ERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDP 127
            ..:.  ::|..:......:....|.::..|...||:::.|.:..|....|. |:.:::|:|.|..
Human   117 CGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPG-VVRMVIGSKFDQY 180

  Fly   128 NHRQVSMAQGFNYAHRQSICFEEVSAKSGRNVYD---------------IFSSLAMDIYTYRRVH 177
            .|..|.......:.....:....|.:..||.:.|               |.:.||..:       
Human   181 MHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQL------- 238

  Fly   178 YNPFSLTSWQEEEDAA 193
                    |.:::.||
Human   239 --------WHQDQVAA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 38/187 (20%)
Rab 8..167 CDD:206640 36/183 (20%)
CPLANE2NP_112169.2 Small GTPase-like 50..258 41/211 (19%)
Ras_like_GTPase 62..>180 CDD:206648 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.