DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and rab33a

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001072527.1 Gene:rab33a / 779982 XenbaseID:XB-GENE-494412 Length:215 Species:Xenopus tropicalis


Alignment Length:191 Identity:69/191 - (36%)
Similarity:97/191 - (50%) Gaps:7/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDDERFK 72
            ||||::|||.||||||..||....|.....:|:|:|.||.:||....::  .:|||||:..|||:
 Frog    18 FKIIVIGDSNVGKTCLTFRFCGGGFPGSSEATIGVDFREKTVEIDGEKI--KVQVWDTAGQERFR 80

  Fly    73 LLKATH-CRSAHGILLVYDITSSKSFQNIDGWMKEIR-RLCPDKVIVLLVGNKSDDPNHRQVSMA 135
            .....| .|:.||::.|||:|...||.|:..|::|.. ...|..|..:|||||.|.....:|...
 Frog    81 HSLVEHYYRNVHGVVFVYDVTKLSSFHNLRTWLQECEGHAVPALVPRVLVGNKCDLLEQVEVPSG 145

  Fly   136 QGFNYAHRQSICFEEVSAK---SGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAA 193
            ...|:|....:...|.|||   ..:||..||.|||..:...:.:.|...:......|.:.|
 Frog   146 LALNFAKAHKMVLFETSAKDPSQAKNVEKIFMSLACQLKAQKSLPYRGSNRPHSSNEREVA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 66/167 (40%)
Rab 8..167 CDD:206640 64/163 (39%)
rab33aNP_001072527.1 Rab33B_Rab33A 16..185 CDD:133315 66/168 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.