DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Cplane2

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001074643.1 Gene:Cplane2 / 76166 MGIID:1923416 Length:258 Species:Mus musculus


Alignment Length:170 Identity:38/170 - (22%)
Similarity:67/170 - (39%) Gaps:27/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLG-----------MDRRECSVEFADWRMGRMLQ 61
            :||.:.|.||||||.|:.:.:..:....|..|.|           :...:|.|.|       ..:
Mouse    56 YKIFVSGKSGVGKTALVAKLAGLEVPIVHHETTGIQTTVVFWPAKLKASDCVVMF-------RFE 113

  Fly    62 VWDTSDDERFKLLKATH----CR-SAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVG 121
            .||..:.   .|.|..|    |: :|...|.::..|...||:::.|.:..:....|. ::.:::|
Mouse   114 FWDCGES---ALKKFDHMLPACKENADAFLFLFSFTDRASFEDLPGQLTRVAGEAPG-LVKIVIG 174

  Fly   122 NKSDDPNHRQVSMAQGFNYAHRQSICFEEVSAKSGRNVYD 161
            :|.|...|..|.......:.....:....|.:..||.:.|
Mouse   175 SKFDQYMHTDVPARDLTAFRQAWELPLFRVKSVPGRRLAD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 38/170 (22%)
Rab 8..167 CDD:206640 38/170 (22%)
Cplane2NP_001074643.1 Small GTPase-like 51..258 38/170 (22%)
Ras_like_GTPase 62..>180 CDD:206648 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.