DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and rab43

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001038812.1 Gene:rab43 / 751627 ZFINID:ZDB-GENE-060825-25 Length:208 Species:Danio rerio


Alignment Length:168 Identity:58/168 - (34%)
Similarity:99/168 - (58%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||..|||:::||.||||||::.||....|..:..:|:|:|....::|....|:  .||:|||:..
Zfish    10 YDLVFKIVLVGDVGVGKTCVVQRFKTGIFIEKQGNTIGVDFTMKTLEIHGKRV--KLQIWDTAGQ 72

  Fly    69 ERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133
            |||:.:..::.|||:|.::.||||...:|.::..||:::::.....::.||:|||.|....|:|.
Zfish    73 ERFRTITQSYYRSANGAIITYDITKKATFLSVPKWMEDVKKYGGSNIVPLLIGNKCDLSESREVP 137

  Fly   134 MAQGFNYAHR-QSICFEEVSAKSGRNVYDIFSSLAMDI 170
            :......||: ..:...|.|||...||.:.|:.:|.::
Zfish   138 LEDAQTMAHQLDFVSAIETSAKDSSNVDEAFNKMASEL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 56/164 (34%)
Rab 8..167 CDD:206640 55/159 (35%)
rab43NP_001038812.1 P-loop_NTPase 11..175 CDD:304359 57/165 (35%)
RAB 14..178 CDD:197555 56/164 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.