DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Rab43

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001034483.1 Gene:Rab43 / 69834 MGIID:1917084 Length:210 Species:Mus musculus


Alignment Length:198 Identity:69/198 - (34%)
Similarity:116/198 - (58%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||..||::::||:.|||||::.||....|:.|..||:|:|....::|....|:  .||:|||:..
Mouse    13 YDFLFKLVLVGDASVGKTCVVQRFKTGAFSARQGSTIGVDFTMKTLEIQGKRV--KLQIWDTAGQ 75

  Fly    69 ERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133
            |||:.:..::.|||:|.:|.|||:...:|.::..|::::|:.....::.||:|||||..:.|:|.
Mouse    76 ERFRTITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLADFREVP 140

  Fly   134 MAQGFNYA-HRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNP-FSLTSWQ----EEEDA 192
            :|:..:.| |...:|..|.|||...||.:.|:.:|.::...   |..| ||..:..    :.:|.
Mouse   141 LAEAQSLAEHYDILCAIETSAKDSSNVEEAFTRVATELIMR---HGGPMFSEKNTDHIQLDSKDI 202

  Fly   193 AES 195
            |||
Mouse   203 AES 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 59/163 (36%)
Rab 8..167 CDD:206640 58/159 (36%)
Rab43NP_001034483.1 Rab19 14..178 CDD:133267 60/165 (36%)
Effector region. /evidence=ECO:0000250 45..53 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.