Sequence 1: | NP_727438.1 | Gene: | Rab9E / 318148 | FlyBaseID: | FBgn0052673 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028764.1 | Gene: | rab33ba / 572060 | ZFINID: | ZDB-GENE-050809-122 | Length: | 239 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 69/215 - (32%) |
---|---|---|---|
Similarity: | 106/215 - (49%) | Gaps: | 44/215 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDDERFK 72
Fly 73 LLKATH-CRSAHGILLVYDITSSKSFQNIDGWMKEIRR-LCPDKVIVLLVGNKSDDPNHRQVSMA 135
Fly 136 QGFNYAHRQSICFEEVSAK-----------SGRNVYDIFSSLAM------------------DIY 171
Fly 172 TYRRVHYNPFSLTSWQEEED 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab9E | NP_727438.1 | RAB | 8..171 | CDD:197555 | 63/193 (33%) |
Rab | 8..167 | CDD:206640 | 61/171 (36%) | ||
rab33ba | NP_001028764.1 | Rab33B_Rab33A | 25..202 | CDD:133315 | 62/176 (35%) |
RAB | 27..203 | CDD:197555 | 62/177 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0084 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |