DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and RABL6

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001167459.1 Gene:RABL6 / 55684 HGNCID:24703 Length:730 Species:Homo sapiens


Alignment Length:157 Identity:39/157 - (24%)
Similarity:64/157 - (40%) Gaps:38/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGR-----MLQV 62
            ||:  .||:|.||...|||.|..|.....|...:..|     :|..|....|....     .::|
Human    41 QYN--MKIVIRGDRNTGKTALWHRLQGRPFVEEYIPT-----QEIQVTSIHWSYKTTDDIVKVEV 98

  Fly    63 WDTSDDERFKL----LKATH------------------CRSAHGILLVYDITSSKSFQNIDGWMK 105
            ||..|..:.|.    ||..:                  .::.:|:::::|||...:|..|   ::
Human    99 WDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYI---LR 160

  Fly   106 EIRRLCPDKVIVLLVGNKSDDPNHRQV 132
            |:.:: |..|.|.::||..|...||.:
Human   161 ELPKV-PTHVPVCVLGNYRDMGEHRVI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 37/152 (24%)
Rab 8..167 CDD:206640 37/152 (24%)
RABL6NP_001167459.1 P-loop_NTPase 44..222 CDD:304359 37/152 (24%)
Ras 45..222 CDD:278499 37/151 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..730
Interaction with CDKN2A. /evidence=ECO:0000269|PubMed:16582619 656..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.